![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (4 families) ![]() |
![]() | Family a.77.1.4: DEATH effector domain, DED [81388] (2 proteins) |
![]() | Protein FADD (Mort1) [81387] (1 species) contains two domains of this superfamily: DED and DD, in this order |
![]() | Species Human (Homo sapiens) [TaxId:9606] [81386] (3 PDB entries) |
![]() | Domain d1a1wa_: 1a1w A: [18425] mutant |
PDB Entry: 1a1w (more details)
SCOP Domain Sequences for d1a1wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a1wa_ a.77.1.4 (A:) FADD (Mort1) {Human (Homo sapiens) [TaxId: 9606]} mdpflvllhsvssslssseltelkylclgrvgkrklervqsgldlfsmlleqndlepght ellrellaslrrhdllrrvddfe
Timeline for d1a1wa_: