Lineage for d1a1ma1 (1a1m A:182-278)
- Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strandsSuperfamily b.1.1: Immunoglobulin [48726] (4 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) Protein Class I MHC, alpha-3 domain [88604] (3 species) Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries) 
Domain d1a1ma1: 1a1m A:182-278 [20753]
Other proteins in same PDB: d1a1ma2, d1a1mb_
Details for d1a1ma1
PDB Entry: 1a1m (more details), 2.3 Å
PDB Description: mhc class i molecule b*5301 complexed with peptide tpydinqml from gag protein of hiv2
PDB Compounds: (A:) HLA class I histocompatibility antigen, BW-53 B*5301 alpha chainSCOP Domain Sequences for d1a1ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a1ma1 b.1.1.2 (A:182-278) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwephh
SCOP Domain Coordinates for d1a1ma1:
Click to download the PDB-style file with coordinates for d1a1ma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1a1ma1:
- d1a1ma1 first appeared (with stable ids) in SCOP 1.55
- d1a1ma1 appears in SCOP 1.71
- d1a1ma1 appears in SCOP 1.75
- d1a1ma1 appears in the current release, SCOPe 2.08
View in 3D
