SCOP 1.73: Domain d1a1ma2: 1a1m A:1-181

Lineage for d1a1ma2 (1a1m A:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)

7. Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (21 PDB entries)

8. Domain d1a1ma2: 1a1m A:1-181 [38266]
   Other proteins in same PDB: d1a1ma1, d1a1mb_

Details for d1a1ma2

PDB Entry: 1a1m, 2.3 Å

PDB Description: mhc class i molecule b*5301 complexed with peptide tpydinqml from gag protein of hiv2

PDB Compounds: (A:) HLA class I histocompatibility antigen, BW-53 B*5301 alpha chain

SCOP Domain Sequences for d1a1ma2:

Sequence; same for both SEQRES and ATOM records:

>d1a1ma2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprteprppwieqegpeyw
drntqifktntqtyrenlrialryynqseagshiiqrmygcdlgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

Timeline for d1a1ma2:

• d1a1ma2 first appeared (with stable ids) in SCOP 1.55
  
• d1a1ma2 appears in SCOP 1.71
  
• d1a1ma2 appears in SCOP 1.75
  
• d1a1ma2 appears in the current release, SCOPe 2.08