Lineage for d1pfba_ (1pfb A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797173Superfamily b.34.13: Chromo domain-like [54160] (3 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 797197Family b.34.13.2: Chromo domain [54165] (7 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 797264Protein Polycomb protein, Pc [101688] (1 species)
  7. 797265Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101689] (2 PDB entries)
  8. 797266Domain d1pfba_: 1pfb A: [94655]
    complexed with histone H3 peptide containing trimethyllysine 27, chain B
    complexed with acy, bme, cl, m3l

Details for d1pfba_

PDB Entry: 1pfb (more details), 1.4 Å

PDB Description: structural basis for specific binding of polycomb chromodomain to histone h3 methylated at k27
PDB Compounds: (A:) Polycomb protein

SCOP Domain Sequences for d1pfba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dlvyaaekiiqkrvkkgvveyrvkwkgwnqryntwepevnildrrlidiyeqtnk

SCOP Domain Coordinates for d1pfba_:

Click to download the PDB-style file with coordinates for d1pfba_.
(The format of our PDB-style files is described here.)

Timeline for d1pfba_: