![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.2: Chromo domain [54165] (8 proteins) lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold |
![]() | Protein Polycomb protein, Pc [101688] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101689] (2 PDB entries) |
![]() | Domain d1pfba_: 1pfb A: [94655] complexed with histone H3 peptide containing trimethyllysine 27, chain B complexed with acy, bme, cl |
PDB Entry: 1pfb (more details), 1.4 Å
SCOPe Domain Sequences for d1pfba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dlvyaaekiiqkrvkkgvveyrvkwkgwnqryntwepevnildrrlidiyeqtnk
Timeline for d1pfba_: