SCOPe 2.07: Domain d1pfba_: 1pfb A:

Lineage for d1pfba_ (1pfb A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.2: Chromo domain [54165] (8 proteins)
   lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold

6. Protein Polycomb protein, Pc [101688] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101689] (2 PDB entries)

8. Domain d1pfba_: 1pfb A: [94655]
   complexed with histone H3 peptide containing trimethyllysine 27, chain B
   complexed with acy, bme, cl

Details for d1pfba_

PDB Entry: 1pfb, 1.4 Å

PDB Description: structural basis for specific binding of polycomb chromodomain to histone h3 methylated at k27

PDB Compounds: (A:) Polycomb protein

SCOPe Domain Sequences for d1pfba_:

Sequence; same for both SEQRES and ATOM records:

>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dlvyaaekiiqkrvkkgvveyrvkwkgwnqryntwepevnildrrlidiyeqtnk

Timeline for d1pfba_:

• d1pfba_ first appeared in SCOP 1.67
  
• d1pfba_ appears in SCOPe 2.06