Lineage for d1hkxa_ (1hkx A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855675Superfamily d.17.4: NTF2-like [54427] (30 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 855907Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (1 protein)
  6. 855908Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (3 species)
  7. 855924Species Mouse (Mus musculus) [TaxId:10090] [89853] (1 PDB entry)
  8. 855925Domain d1hkxa_: 1hkx A: [83567]

Details for d1hkxa_

PDB Entry: 1hkx (more details), 2.65 Å

PDB Description: crystal structure of calcium/calmodulin-dependent protein kinase
PDB Compounds: (A:) calcium/calmodulin-dependent protein kinase type II alpha chain

SCOP Domain Sequences for d1hkxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkxa_ d.17.4.7 (A:) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Mouse (Mus musculus) [TaxId: 10090]}
mttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegldf
hrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseetrv
whrrdgkwqivhfhrsgapsv

SCOP Domain Coordinates for d1hkxa_:

Click to download the PDB-style file with coordinates for d1hkxa_.
(The format of our PDB-style files is described here.)

Timeline for d1hkxa_: