| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (30 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
| Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (1 protein) |
| Protein Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89852] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [89853] (1 PDB entry) |
| Domain d1hkxh_: 1hkx H: [83574] |
PDB Entry: 1hkx (more details), 2.65 Å
SCOP Domain Sequences for d1hkxh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkxh_ d.17.4.7 (H:) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Mouse (Mus musculus) [TaxId: 10090]}
phmttiededtkvrkqeiikvteqlieaisngdfesytkmcdpgmtafepealgnlvegl
dfhrfyfenlwsrnskpvhttilnphihlmgdesaciayiritqyldaggiprtaqseet
rvwhrrdgkwqivhfhrsgapsv
Timeline for d1hkxh_: