Lineage for d1h2ea_ (1h2e A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 838854Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 838855Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) (S)
  5. 838856Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (3 proteins)
  6. 838862Protein Broad specificity phosphatase PhoE (YhfR) [69539] (1 species)
  7. 838863Species Bacillus stearothermophilus [TaxId:1422] [69540] (3 PDB entries)
  8. 838864Domain d1h2ea_: 1h2e A: [70857]
    complexed with edo, po4

Details for d1h2ea_

PDB Entry: 1h2e (more details), 1.69 Å

PDB Description: bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate
PDB Compounds: (A:) phosphatase

SCOP Domain Sequences for d1h2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus [TaxId: 1422]}
attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
tiievdggtfhvavegdvshieevkev

SCOP Domain Coordinates for d1h2ea_:

Click to download the PDB-style file with coordinates for d1h2ea_.
(The format of our PDB-style files is described here.)

Timeline for d1h2ea_: