Lineage for d1h2ea_ (1h2e A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 183050Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
  4. 183051Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 183052Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (2 proteins)
  6. 183053Protein Broad specificity phosphatase PhoE (YhfR) [69539] (1 species)
  7. 183054Species Bacillus stearothermophilus [TaxId:1422] [69540] (3 PDB entries)
  8. 183055Domain d1h2ea_: 1h2e A: [70857]

Details for d1h2ea_

PDB Entry: 1h2e (more details), 1.69 Å

PDB Description: bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate

SCOP Domain Sequences for d1h2ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2ea_ c.60.1.1 (A:) Broad specificity phosphatase PhoE (YhfR) {Bacillus stearothermophilus}
attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
tiievdggtfhvavegdvshieevkev

SCOP Domain Coordinates for d1h2ea_:

Click to download the PDB-style file with coordinates for d1h2ea_.
(The format of our PDB-style files is described here.)

Timeline for d1h2ea_: