PDB entry 1h2e

View 1h2e on RCSB PDB site
Description: bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate
Class: hydrolase
Keywords: hydrolase, broad specificity phosphatase, dpgm homolog
Deposited on 2002-08-08, released 2002-08-12
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.213
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phosphatase
  Species: Bacillus stearothermophilus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9ALU0 (201-206)
  • Uniprot Q9ALU0 (6-200)
  Domains in SCOP 1.75: d1h2ea_
• Heterogens: PO4, EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1h2eA (A:)
  attlyltrhgetkwnverrmqgwqdspltekgrqdamrlgkrleavelaaiytstsgral
  etaeivrggrlipiyqderlreihlgdwegkthdeirqmdpiafdhfwqaphlyapqrge
  rfcdvqqraleavqsivdrhegetvlivthgvvlktlmaafkdtpldhlwsppymygtsv
  tiievdggtfhvavegdvshieevkev