Lineage for d1i74a_ (1i74 A:)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
consists of two non-similar domains
Domain 1 has parallel sheet of 6 strands, order 321456
Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the restSuperfamily c.107.1: DHH phosphoesterases [64182] (2 families) 
constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domainsFamily c.107.1.1: Manganese-dependent inorganic pyrophosphatase (family II) [64183] (1 protein) Protein Manganese-dependent inorganic pyrophosphatase (family II) [64184] (3 species) 
Species Streptococcus mutans [TaxId:1309] [64185] (1 PDB entry) 
Domain d1i74a_: 1i74 A: [61867]
CASP4
Details for d1i74a_
PDB Entry: 1i74 (more details), 2.2 Å
PDB Description: streptococcus mutans inorganic pyrophosphatase
PDB Compounds: (A:) probable manganese-dependent inorganic pyrophosphataseSCOP Domain Sequences for d1i74a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i74a_ c.107.1.1 (A:) Manganese-dependent inorganic pyrophosphatase (family II) {Streptococcus mutans [TaxId: 1309]}
skilvfghqnpdsdaigssmayaylkrqlgvdaqavalgnpneetafvldyfgiqappvv
ksaqaegakqviltdhnefqqsiadirevevvevvdhhrvanfetanplymrlepvgsas
sivyrlykengvaipkeiagvmlsglisdtlllksptthasdpavaedlakiagvdlqey
glamlkagtnlasktaaqlvdidaktfelngsqvrvaqvntvdinevlerqneieeaika
sqaangysdfvlmitdilnsnseilalgnntdkveaafnftlknnhaflagavsrkkqvv
pqltesfng
SCOP Domain Coordinates for d1i74a_:
Click to download the PDB-style file with coordinates for d1i74a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1i74a_:
- d1i74a_ first appeared in SCOP 1.57
- d1i74a_ appears in SCOP 1.73
- d1i74a_ appears in SCOPe 2.01
- d1i74a_ appears in the current release, SCOPe 2.08
View in 3D
