Class g: Small proteins [56992] (90 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) |
Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein) |
Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (8 species) |
Species Escherichia coli [TaxId:562] [57778] (6 PDB entries) contains a rudiment form of the domain that lacks zn-binding site |
Domain d1e4ya2: 1e4y A:122-156 [45181] Other proteins in same PDB: d1e4ya1, d1e4yb1 |
PDB Entry: 1e4y (more details), 1.85 Å
SCOP Domain Sequences for d1e4ya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e4ya2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} grrvhapsgrvyhvkfnppkvegkddvtgeelttr
Timeline for d1e4ya2: