PDB entry 1e4y

View 1e4y on RCSB PDB site
Description: mutant p9l of adenylate kinase from e. coli, modified in the gly-loop
Class: transferase(phosphotransferase)
Keywords: transferase(phosphotransferase)
Deposited on 2000-07-12, released 2000-08-04
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.178
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: adenylate kinase
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05082 (0-213)
      • engineered mutation (8)
      • conflict (9)
    Domains in SCOP 1.75: d1e4ya1, d1e4ya2
  • Chain 'B':
    Compound: adenylate kinase
    Species: ESCHERICHIA COLI
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05082 (0-213)
      • engineered mutation (8)
      • conflict (9)
    Domains in SCOP 1.75: d1e4yb1, d1e4yb2
  • Heterogens: AP5

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4yA (A:)
    mriillgalvagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1e4yB (B:)
    mriillgalvagkgtqaqfimekygipqistgdmlraavksgselgkqakdimdagklvt
    delvialvkeriaqedcrngflldgfprtipqadamkeaginvdyvlefdvpdelivdri
    vgrrvhapsgrvyhvkfnppkvegkddvtgeelttrkddqeetvrkrlveyhqmtaplig
    yyskeaeagntkyakvdgtkpvaevradlekilg