Lineage for d1bi5a2 (1bi5 A:236-389)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.95: Thiolase-like [53900] (1 superfamily)
consists of two similar domains related by pseudo dyad; duplication
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the restSuperfamily c.95.1: Thiolase-like [53901] (2 families) 
Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins) Protein Chalcone synthase [53915] (1 species) Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)
Uniprot P30074
Domain d1bi5a2: 1bi5 A:236-389 [35986]
Details for d1bi5a2
PDB Entry: 1bi5 (more details), 1.56 Å
PDB Description: chalcone synthase from alfalfa
PDB Compounds: (A:) chalcone synthaseSCOP Domain Sequences for d1bi5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bi5a2 c.95.1.2 (A:236-389) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}
ifemvwtaqtiapdsegaidghlreagltfhllkdvpgivsknitkalveafeplgisdy
nsifwiahpggpaildqveqklalkpekmnatrevlseygnmssacvlfildemrkkstq
nglkttgeglewgvlfgfgpgltietvvlrsvai
SCOP Domain Coordinates for d1bi5a2:
Click to download the PDB-style file with coordinates for d1bi5a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bi5a2:
- d1bi5a2 first appeared (with stable ids) in SCOP 1.55
- d1bi5a2 appears in SCOP 1.73
- d1bi5a2 appears in SCOPe 2.01
- d1bi5a2 appears in the current release, SCOPe 2.08
View in 3D
