Lineage for d1bi5a1 (1bi5 A:1-235)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846958Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 846959Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 847355Family c.95.1.2: Chalcone synthase-like [53914] (8 proteins)
  6. 847392Protein Chalcone synthase [53915] (1 species)
  7. 847393Species Alfalfa (Medicago sativa) [TaxId:3879] [53916] (16 PDB entries)
    Uniprot P30074
  8. 847394Domain d1bi5a1: 1bi5 A:1-235 [35985]

Details for d1bi5a1

PDB Entry: 1bi5 (more details), 1.56 Å

PDB Description: chalcone synthase from alfalfa
PDB Compounds: (A:) chalcone synthase

SCOP Domain Sequences for d1bi5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]}
mvsvseirkaqraegpatilaigtanpancveqstypdfyfkitnsehktelkekfqrmc
dksmikrrymylteeilkenpnvceymapsldarqdmvvvevprlgkeaavkaikewgqp
kskithlivcttsgvdmpgadyqltkllglrpyvkrymmyqqgcfaggtvlrlakdlaen
nkgarvlvvcsevtavtfrgpsdthldslvgqalfgdgaaalivgsdpvpeiekp

SCOP Domain Coordinates for d1bi5a1:

Click to download the PDB-style file with coordinates for d1bi5a1.
(The format of our PDB-style files is described here.)

Timeline for d1bi5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bi5a2