Lineage for d1e0ca1 (1e0c A:1-135)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) 
Pfam PF00581
the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
duplication: consists of two domains of this fold
Protein Sulfurtransferase [52830] (2 species) Species Azotobacter vinelandii [TaxId:354] [52831] (3 PDB entries) 
Domain d1e0ca1: 1e0c A:1-135 [32717]
Details for d1e0ca1
PDB Entry: 1e0c (more details), 1.8 Å
PDB Description: sulfurtransferase from azotobacter vinelandii
PDB Compounds: (A:) sulfurtransferaseSCOP Domain Sequences for d1e0ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]}
mddfaslplviepadlqarlsapelilvdltsaaryaeghipgarfvdpkrtqlgqppap
glqppreqleslfgelghrpeavyvvyddegggwagrfiwlldvigqqryhylnggltaw
laedrplsrelpapa
SCOP Domain Coordinates for d1e0ca1:
Click to download the PDB-style file with coordinates for d1e0ca1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e0ca1:
- d1e0ca1 first appeared (with stable ids) in SCOP 1.55
- d1e0ca1 appears in SCOP 1.73
- d1e0ca1 appears in SCOPe 2.01
- d1e0ca1 appears in the current release, SCOPe 2.08
View in 3D
