Lineage for d1hpca_ (1hpc A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 810794Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 810795Superfamily b.84.1: Single hybrid motif [51230] (1 family) (S)
    7 to 8 strands in 2 beta-sheets
  5. 810796Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)
  6. 810838Protein Protein H of glycine cleavage system [51236] (2 species)
  7. 810839Species Pea (Pisum sativum) [TaxId:3888] [51237] (3 PDB entries)
  8. 810840Domain d1hpca_: 1hpc A: [28221]

Details for d1hpca_

PDB Entry: 1hpc (more details), 2 Å

PDB Description: refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase
PDB Compounds: (A:) h protein of the glycine cleavage system

SCOP Domain Sequences for d1hpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]}
snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
tkfceeedaah

SCOP Domain Coordinates for d1hpca_:

Click to download the PDB-style file with coordinates for d1hpca_.
(The format of our PDB-style files is described here.)

Timeline for d1hpca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hpcb_