Lineage for d1hpca_ (1hpc A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.84: Barrel-sandwich hybrid [51229] (3 superfamilies) 
Superfamily b.84.1: Single hybrid motif [51230] (1 family) 
Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (5 proteins) 
Protein Protein H of glycine cleavage system [51236] (1 species) Species Pea (Pisum sativum) [TaxId:3888] [51237] (3 PDB entries) 
Domain d1hpca_: 1hpc A: [28221]
Details for d1hpca_
PDB Entry: 1hpc (more details), 2.6 Å
PDB Description: refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase
SCOP Domain Sequences for d1hpca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hpca_ b.84.1.1 (A:) Protein H of glycine cleavage system {Pea (Pisum sativum)}
snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
tkfceeedaah
SCOP Domain Coordinates for d1hpca_:
Click to download the PDB-style file with coordinates for d1hpca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hpca_:
- d1hpca_ appears in SCOP 1.57
- d1hpca_ appears in the current release, SCOPe 2.08
View in 3D
