SCOP 1.75: Domain d1hpcb_: 1hpc B:

Lineage for d1hpcb_ (1hpc B:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (1 family)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.1: Biotinyl/lipoyl-carrier proteins and domains [51231] (6 proteins)

6. Protein Protein H of glycine cleavage system [51236] (2 species)

7. Species Pea (Pisum sativum) [TaxId:3888] [51237] (3 PDB entries)

8. Domain d1hpcb_: 1hpc B: [28222]
   complexed with lpa

Details for d1hpcb_

PDB Entry: 1hpc, 2 Å

PDB Description: refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase

PDB Compounds: (B:) h protein of the glycine cleavage system

SCOP Domain Sequences for d1hpcb_:

Sequence; same for both SEQRES and ATOM records:

>d1hpcb_ b.84.1.1 (B:) Protein H of glycine cleavage system {Pea (Pisum sativum) [TaxId: 3888]}
snvldglkyapshewvkhegsvatigitdhaqdhlgevvfvelpepgvsvtkgkgfgave
svkatsdvnspisgevievntgltgkpglinsspyedgwmikikptspdelesllgakey
tkfceeedaah

Timeline for d1hpcb_:

• d1hpcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hpcb_ appears in SCOP 1.73
  
• d1hpcb_ appears in SCOPe 2.01
  
• d1hpcb_ appears in the current release, SCOPe 2.08