Lineage for d1jmca2 (1jmc A:299-420)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) 
Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
barrel, closed; n=5, S=10
Protein Replication protein A 70 KDa subunit (RPA70) [50267] (1 species)
duplication: consists of three domains of this fold; contains zinc-finger insert in the C-terminal domain, residues 479-511Species Human (Homo sapiens) [TaxId:9606] [50268] (6 PDB entries) 
Domain d1jmca2: 1jmc A:299-420 [25301]
the N-terminal two domains in complex with ssDNA
protein/DNA complex
Details for d1jmca2
PDB Entry: 1jmc (more details), 2.4 Å
PDB Description: single stranded dna-binding domain of human replication protein a bound to single stranded dna, rpa70 subunit, residues 183-420
PDB Compounds: (A:) protein (replication protein a (rpa))SCOP Domain Sequences for d1jmca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jmca2 b.40.4.3 (A:299-420) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]}
qfdftgiddlenkskdslvdiigicksyedatkitvrsnnrevakrniylmdtsgkvvta
tlwgedadkfdgsrqpvlaikgarvsdfggrslsvlssstiianpdipeayklrgwfdae
gq
SCOP Domain Coordinates for d1jmca2:
Click to download the PDB-style file with coordinates for d1jmca2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jmca2:
- d1jmca2 first appeared (with stable ids) in SCOP 1.55
- d1jmca2 appears in SCOP 1.73
- d1jmca2 appears in SCOPe 2.01
- d1jmca2 appears in the current release, SCOPe 2.08
View in 3D
