Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families) the N-terminal domains of these repressors bind DNA |
Family b.34.1.2: FeoA-like [50041] (4 proteins) |
Protein Diphtheria toxin repressor (DtxR) [50042] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [50043] (15 PDB entries) Uniprot P33120 |
Domain d2dtra3: 2dtr A:148-226 [24450] Other proteins in same PDB: d2dtra1, d2dtra2 complexed with co, so4 |
PDB Entry: 2dtr (more details), 1.9 Å
SCOP Domain Sequences for d2dtra3:
Sequence, based on SEQRES records: (download)
>d2dtra3 b.34.1.2 (A:148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrdghitlshn gkdvellddlahtirieel
>d2dtra3 b.34.1.2 (A:148-226) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} pgtrvidaatsmprkvrivqineifqvetdqftqlldadirvgseveivdrhitlshngk dvellddlahtirieel
Timeline for d2dtra3: