Lineage for d1neua_ (1neu A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 783664Protein Myelin membrane adhesion molecule P0 [48728] (1 species)
  7. 783665Species Rat (Rattus norvegicus) [TaxId:10116] [48729] (1 PDB entry)
  8. 783666Domain d1neua_: 1neu A: [19704]

Details for d1neua_

PDB Entry: 1neu (more details), 1.9 Å

PDB Description: structure of myelin membrane adhesion molecule p0
PDB Compounds: (A:) myelin p0 protein

SCOP Domain Sequences for d1neua_:

Sequence, based on SEQRES records: (download)

>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]}
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknppdivgktsqvtlyvfe

Sequence, based on observed residues (ATOM records): (download)

>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]}
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknvgktsqvtlyvfe

SCOP Domain Coordinates for d1neua_:

Click to download the PDB-style file with coordinates for d1neua_.
(The format of our PDB-style files is described here.)

Timeline for d1neua_: