PDB entry 1neu

View 1neu on RCSB PDB site
Description: structure of myelin membrane adhesion molecule p0
Class: structural protein
Keywords: myelin, structural protein, glycoprotein, transmembrane, phosphorylation, immunoglobulin fold, signal, myelin membrane adhesion molecule
Deposited on 1996-09-24, released 1997-05-15
The last revision prior to the SCOP 1.75 freeze date was dated 1997-05-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.215
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myelin p0 protein
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1neua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1neuA (A:)
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknppdivgktsqvtlyvfek
vptr

    Sequence, based on observed residues (ATOM records): (download) 
    >1neuA (A:)
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknvgktsqvtlyvfe