SCOP 1.73: Domain d1neua_: 1neu A:

Lineage for d1neua_ (1neu A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Myelin membrane adhesion molecule P0 [48728] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48729] (1 PDB entry)

8. Domain d1neua_: 1neu A: [19704]

Details for d1neua_

PDB Entry: 1neu, 1.9 Å

PDB Description: structure of myelin membrane adhesion molecule p0

PDB Compounds: (A:) myelin p0 protein

SCOP Domain Sequences for d1neua_:

Sequence, based on SEQRES records:

>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]}
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknppdivgktsqvtlyvfe

Sequence, based on observed residues (ATOM records):

>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]}
ivvytdrevygavgsqvtlhcsfwssewvsddisftwryqpeggrdaisifhyakgqpyi
devgtfkeriqwvgdpswkdgsivihnldysdngtftcdvknvgktsqvtlyvfe

Timeline for d1neua_:

• d1neua_ first appeared (with stable ids) in SCOP 1.55, called d1neu__
  
• d1neua_ was called d1neu__ in SCOP 1.71
  
• d1neua_ appears in SCOP 1.75
  
• d1neua_ appears in the current release, SCOPe 2.08