Class a: All alpha proteins [46456] (284 folds) |
Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (1 family) |
Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (3 proteins) |
Protein Diphtheria toxin repressor (DtxR) [47981] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [47982] (17 PDB entries) Uniprot P33120 |
Domain d2dtra2: 2dtr A:65-140 [18399] Other proteins in same PDB: d2dtra1, d2dtra3 complexed with co, so4 |
PDB Entry: 2dtr (more details), 1.9 Å
SCOP Domain Sequences for d2dtra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dtra2 a.76.1.1 (A:65-140) Diphtheria toxin repressor (DtxR) {Corynebacterium diphtheriae [TaxId: 1717]} tptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdvs rspfgnpipgldelgv
Timeline for d2dtra2: