Lineage for d1jvra_ (1jvr A:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 771619Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 771620Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 771645Family a.61.1.2: HTLV-II matrix protein [47842] (1 protein)
    the C-terminal helix region is disordered(?)
  6. 771646Protein HTLV-II matrix protein [47843] (1 species)
  7. 771647Species Human T-cell leukemia virus type 2 [TaxId:11909] [47844] (1 PDB entry)
  8. 771648Domain d1jvra_: 1jvr A: [18132]

Details for d1jvra_

PDB Entry: 1jvr (more details)

PDB Description: structure of the htlv-ii matrix protein, nmr, 20 structures
PDB Compounds: (A:) human T-cell leukemia virus type II matrix protein

SCOP Domain Sequences for d1jvra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvra_ a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell leukemia virus type 2 [TaxId: 11909]}
hmgqihglsptpipkaprglsthhwlnflqaayrlqpgpsdfdfqqlrrflklalktpiw
lnpidysllaslipkgypgrvveiinilvknqvspsapaapvptpicptttpppppppsp
eahvpppyveptttqcf

SCOP Domain Coordinates for d1jvra_:

Click to download the PDB-style file with coordinates for d1jvra_.
(The format of our PDB-style files is described here.)

Timeline for d1jvra_: