![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
![]() | Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) ![]() the 5th, C-terminal helix is missing in some of the member structures |
![]() | Family a.61.1.2: HTLV-II matrix protein [47842] (1 protein) the C-terminal helix region is disordered(?) |
![]() | Protein HTLV-II matrix protein [47843] (1 species) |
![]() | Species Human T-cell leukemia virus type 2 [TaxId:11909] [47844] (1 PDB entry) |
![]() | Domain d1jvra_: 1jvr A: [18132] |
PDB Entry: 1jvr (more details)
SCOPe Domain Sequences for d1jvra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jvra_ a.61.1.2 (A:) HTLV-II matrix protein {Human T-cell leukemia virus type 2 [TaxId: 11909]} hmgqihglsptpipkaprglsthhwlnflqaayrlqpgpsdfdfqqlrrflklalktpiw lnpidysllaslipkgypgrvveiinilvknqvspsapaapvptpicptttpppppppsp eahvpppyveptttqcf
Timeline for d1jvra_: