SCOP 1.55: Domain d1jvr__: 1jvr -

Lineage for d1jvr__ (1jvr -)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (4 families)

5. Family a.61.1.2: HTLV-II matrix protein [47842] (1 protein)

6. Protein HTLV-II matrix protein [47843] (1 species)

7. Species Human T-cell leukemia virus type 2 [TaxId:11909] [47844] (1 PDB entry)

8. Domain d1jvr__: 1jvr - [18132]

Details for d1jvr__

PDB Entry: 1jvr

PDB Description: structure of the htlv-ii matrix protein, nmr, 20 structures

SCOP Domain Sequences for d1jvr__:

Sequence; same for both SEQRES and ATOM records:

>d1jvr__ a.61.1.2 (-) HTLV-II matrix protein {Human T-cell leukemia virus type 2}
hmgqihglsptpipkaprglsthhwlnflqaayrlqpgpsdfdfqqlrrflklalktpiw
lnpidysllaslipkgypgrvveiinilvknqvspsapaapvptpicptttpppppppsp
eahvpppyveptttqcf

Timeline for d1jvr__:

• d1jvr__ appears in SCOP 1.57
  
• d1jvr__ appears in the current release, SCOPe 2.08, called d1jvra_