Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451 |
Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (4 families) Pfam PF00581 the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology |
Family c.46.1.4: Ubiquitin carboxyl-terminal hydrolase 8, USP8 [117586] (1 protein) |
Protein Ubiquitin carboxyl-terminal hydrolase 8, USP8 [117587] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117588] (2 PDB entries) Uniprot P40818 174-317 |
Domain d2gwfa1: 2gwf A:181-315 [135802] Other proteins in same PDB: d2gwfb1, d2gwfd1, d2gwff1 automatically matched to d1whba_ |
PDB Entry: 2gwf (more details), 2.3 Å
SCOP Domain Sequences for d2gwfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} gaitakelytmmtdknisliimdarrmqdyqdscilhslsvpeeaispgvtaswieahlp ddskdtwkkrgnveyvvlldwfssakdlqigttlrslkdalfkwesktvlrneplvlegg yenwllcypqyttna
Timeline for d2gwfa1: