SCOP 1.75: Domain d2gwfd1: 2gwf D:197-317

Lineage for d2gwfd1 (2gwf D:197-317)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.345: NRDP1 C-terminal domain-like [160087] (1 superfamily)
   alpha-beta-alpha(3)-beta(3); a pseudo barrel beta-sheet of an SH3-like topology, surrounded by helices

4. Superfamily d.345.1: NRDP1 C-terminal domain-like [160088] (1 family)

5. Family d.345.1.1: USP8 interacting domain [160089] (1 protein)
   Pfam PF08941

6. Protein E3 ubiquitin-protein ligase NRDP1 [160090] (1 species)
   RING finger protein 41

7. Species Human (Homo sapiens) [TaxId:9606] [160091] (3 PDB entries)
   Uniprot Q9H4P4 193-317! Uniprot Q9H4P4 197-317

8. Domain d2gwfd1: 2gwf D:197-317 [145230]
   Other proteins in same PDB: d2gwfa1, d2gwfc1, d2gwfe1
   automatically matched to 2GWF B:197-317

Details for d2gwfd1

PDB Entry: 2gwf, 2.3 Å

PDB Description: Structure of a USP8-NRDP1 complex

PDB Compounds: (D:) RING finger protein 41

SCOP Domain Sequences for d2gwfd1:

Sequence; same for both SEQRES and ATOM records:

>d2gwfd1 d.345.1.1 (D:197-317) E3 ubiquitin-protein ligase NRDP1 {Human (Homo sapiens) [TaxId: 9606]}
neilewvnslqparvtrwggmistpdavlqavikrslvesgcpasivnelienaherswp
qglatletrqmnrryyenyvakripgkqavvvmacenqhmgddmvqepglvmifahgvee
i

Timeline for d2gwfd1:

• d2gwfd1 is new in SCOP 1.75
  
• d2gwfd1 is called d2gwfd_ in SCOPe 2.01
  
• d2gwfd1 appears in the current release, SCOPe 2.08, called d2gwfd2