SCOPe 2.08: Domain d2gwfa2: 2gwf A:181-315

Lineage for d2gwfa2 (2gwf A:181-315)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.4: Ubiquitin carboxyl-terminal hydrolase 8, USP8 [117586] (1 protein)
   automatically mapped to Pfam PF00581

6. Protein Ubiquitin carboxyl-terminal hydrolase 8, USP8 [117587] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117588] (2 PDB entries)
   Uniprot P40818 174-317

8. Domain d2gwfa2: 2gwf A:181-315 [135802]
   Other proteins in same PDB: d2gwfa3, d2gwfb1, d2gwfc3, d2gwfd2, d2gwfd3, d2gwfe3, d2gwff_
   automated match to d2gwfa1

Details for d2gwfa2

PDB Entry: 2gwf, 2.3 Å

PDB Description: Structure of a USP8-NRDP1 complex

PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 8

SCOPe Domain Sequences for d2gwfa2:

Sequence; same for both SEQRES and ATOM records:

>d2gwfa2 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]}
gaitakelytmmtdknisliimdarrmqdyqdscilhslsvpeeaispgvtaswieahlp
ddskdtwkkrgnveyvvlldwfssakdlqigttlrslkdalfkwesktvlrneplvlegg
yenwllcypqyttna

Timeline for d2gwfa2:

• d2gwfa2 first appeared in SCOP 1.73, called d2gwfa1
  
• d2gwfa2 appears in SCOPe 2.07