![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (23 families) ![]() |
![]() | Family c.47.1.1: Thioltransferase [52834] (15 proteins) |
![]() | Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102436] (6 PDB entries) |
![]() | Domain d2fwha1: 2fwh A:428-544 [134242] automatically matched to d1uc7a_ complexed with iod, peg |
PDB Entry: 2fwh (more details), 0.99 Å
SCOP Domain Sequences for d2fwha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdr
Timeline for d2fwha1: