Lineage for d2fwha_ (2fwh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876180Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (2 species)
  7. 2876187Species Escherichia coli [TaxId:562] [102436] (5 PDB entries)
  8. 2876188Domain d2fwha_: 2fwh A: [134242]
    automated match to d1uc7a_
    complexed with iod, peg

Details for d2fwha_

PDB Entry: 2fwh (more details), 0.99 Å

PDB Description: atomic resolution crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (reduced form at pH7)
PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d2fwha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fwha_ c.47.1.1 (A:) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll
qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdr

SCOPe Domain Coordinates for d2fwha_:

Click to download the PDB-style file with coordinates for d2fwha_.
(The format of our PDB-style files is described here.)

Timeline for d2fwha_: