SCOP 1.73: Domain d2fwha1: 2fwh A:428-544

Lineage for d2fwha1 (2fwh A:428-544)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.1: Thioltransferase [52834] (15 proteins)

6. Protein Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) [102435] (1 species)

7. Species Escherichia coli [TaxId:562] [102436] (6 PDB entries)

8. Domain d2fwha1: 2fwh A:428-544 [134242]
   automatically matched to d1uc7a_
   complexed with iod, peg

Details for d2fwha1

PDB Entry: 2fwh, 0.99 Å

PDB Description: atomic resolution crystal structure of the C-terminal domain of the electron transfer catalyst DsbD (reduced form at pH7)

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOP Domain Sequences for d2fwha1:

Sequence; same for both SEQRES and ATOM records:

>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]}
hlnftqiktvdelnqalveakgkpvmldlyadwcvackefekytfsdpqvqkaladtvll
qanvtandaqdvallkhlnvlglptilffdgqgqehpqarvtgfmdaetfsahlrdr

Timeline for d2fwha1:

• d2fwha1 is new in SCOP 1.73
  
• d2fwha1 appears in SCOP 1.75
  
• d2fwha1 appears in the current release, SCOPe 2.08, called d2fwha_