Lineage for d2f5ga1 (2f5g A:2-131)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.57: Transposase IS200-like [143422] (1 family) 
contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimerFamily d.58.57.1: Transposase IS200-like [143423] (3 proteins)
Pfam PF01797
Protein Putative transposase SSO1474 [143424] (1 species) Species Archaeon Sulfolobus solfataricus [TaxId:2287] [143425] (2 PDB entries)
Uniprot Q97Y68 2-131
Domain d2f5ga1: 2f5g A:2-131 [132991]
automatically matched to 2F4F A:2-131
Details for d2f5ga1
PDB Entry: 2f5g (more details), 1.7 Å
PDB Description: Crystal structure of IS200 transposase
PDB Compounds: (A:) Transposase, putativeSCOP Domain Sequences for d2f5ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5ga1 d.58.57.1 (A:2-131) Putative transposase SSO1474 {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
elkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdhi
hlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikky
ieeqwrkege
SCOP Domain Coordinates for d2f5ga1:
Click to download the PDB-style file with coordinates for d2f5ga1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2f5ga1:
- d2f5ga1 first appeared in SCOP 1.73
- d2f5ga1 is called d2f5ga_ in SCOPe 2.01
- d2f5ga1 appears in the current release, SCOPe 2.08, called d2f5ga_
View in 3D
