SCOP 1.73: Domain d2f5ga1: 2f5g A:2-131

Lineage for d2f5ga1 (2f5g A:2-131)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.57: Transposase IS200-like [143422] (1 family)
   contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer

5. Family d.58.57.1: Transposase IS200-like [143423] (3 proteins)
   Pfam PF01797

6. Protein Putative transposase SSO1474 [143424] (1 species)

7. Species Archaeon Sulfolobus solfataricus [TaxId:2287] [143425] (2 PDB entries)

8. Domain d2f5ga1: 2f5g A:2-131 [132991]
   automatically matched to 2F4F A:2-131

Details for d2f5ga1

PDB Entry: 2f5g, 1.7 Å

PDB Description: Crystal structure of IS200 transposase

PDB Compounds: (A:) Transposase, putative

SCOP Domain Sequences for d2f5ga1:

Sequence; same for both SEQRES and ATOM records:

>d2f5ga1 d.58.57.1 (A:2-131) Putative transposase SSO1474 {Archaeon Sulfolobus solfataricus [TaxId: 2287]}
elkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdhi
hlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikky
ieeqwrkege

Timeline for d2f5ga1:

• d2f5ga1 is new in SCOP 1.73
  
• d2f5ga1 appears in SCOP 1.75
  
• d2f5ga1 appears in the current release, SCOPe 2.08, called d2f5ga_