SCOPe 2.08: Domain d2f5ga_: 2f5g A:

Lineage for d2f5ga_ (2f5g A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.57: Transposase IS200-like [143422] (1 family)
   contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
   automatically mapped to Pfam PF01797

5. Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
   Pfam PF01797

6. Protein automated matches [190624] (2 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [187685] (2 PDB entries)

8. Domain d2f5ga_: 2f5g A: [132991]
   automated match to d2f4fa1

Details for d2f5ga_

PDB Entry: 2f5g, 1.7 Å

PDB Description: Crystal structure of IS200 transposase

PDB Compounds: (A:) Transposase, putative

SCOPe Domain Sequences for d2f5ga_:

Sequence; same for both SEQRES and ATOM records:

>d2f5ga_ d.58.57.1 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
elkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdhi
hlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikky
ieeqwrkege

Timeline for d2f5ga_:

• d2f5ga_ first appeared in SCOP 1.73, called d2f5ga1
  
• d2f5ga_ appears in SCOPe 2.07