Lineage for d2bzga1 (2bzg A:17-245)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 840165Family c.66.1.36: Thiopurine S-methyltransferase [102566] (1 protein)
  6. 840166Protein Thiopurine S-methyltransferase [102567] (2 species)
  7. 840167Species Human (Homo sapiens) [TaxId:9606] [142579] (2 PDB entries)
    Uniprot P51580 17-245
  8. 840168Domain d2bzga1: 2bzg A:17-245 [129559]
    complexed with b3p, sah

Details for d2bzga1

PDB Entry: 2bzg (more details), 1.58 Å

PDB Description: crystal structure of thiopurine s-methyltransferase.
PDB Compounds: (A:) thiopurine s-methyltransferase

SCOP Domain Sequences for d2bzga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
evqknqvltleewqdkwvngktafhqeqghqllkkhldtflkgksglrvffplcgkavem
kwfadrghsvvgveiselgiqeffteqnlsyseepiteipgtkvfksssgnislyccsif
dlprtnigkfdmiwdrgalvainpgdrkcyadtmfsllgkkfqyllcvlsydptkhpgpp
fyvphaeierlfgkicnirclekvdafeerhkswgidclfeklylltek

SCOP Domain Coordinates for d2bzga1:

Click to download the PDB-style file with coordinates for d2bzga1.
(The format of our PDB-style files is described here.)

Timeline for d2bzga1: