Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) |
Family c.66.1.36: Thiopurine S-methyltransferase [102566] (1 protein) |
Protein Thiopurine S-methyltransferase [102567] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [142579] (2 PDB entries) |
Domain d2bzga1: 2bzg A:17-245 [129559] complexed with b3p, sah |
PDB Entry: 2bzg (more details), 1.58 Å
SCOP Domain Sequences for d2bzga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} evqknqvltleewqdkwvngktafhqeqghqllkkhldtflkgksglrvffplcgkavem kwfadrghsvvgveiselgiqeffteqnlsyseepiteipgtkvfksssgnislyccsif dlprtnigkfdmiwdrgalvainpgdrkcyadtmfsllgkkfqyllcvlsydptkhpgpp fyvphaeierlfgkicnirclekvdafeerhkswgidclfeklylltek
Timeline for d2bzga1: