Lineage for d2bzga1 (2bzg A:17-245)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130202Family c.66.1.36: Thiopurine S-methyltransferase [102566] (1 protein)
    automatically mapped to Pfam PF05724
  6. 2130203Protein Thiopurine S-methyltransferase [102567] (3 species)
  7. 2130204Species Human (Homo sapiens) [TaxId:9606] [142579] (2 PDB entries)
    Uniprot P51580 17-245
  8. 2130205Domain d2bzga1: 2bzg A:17-245 [129559]
    complexed with b3p, sah

Details for d2bzga1

PDB Entry: 2bzg (more details), 1.58 Å

PDB Description: crystal structure of thiopurine s-methyltransferase.
PDB Compounds: (A:) thiopurine s-methyltransferase

SCOPe Domain Sequences for d2bzga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
evqknqvltleewqdkwvngktafhqeqghqllkkhldtflkgksglrvffplcgkavem
kwfadrghsvvgveiselgiqeffteqnlsyseepiteipgtkvfksssgnislyccsif
dlprtnigkfdmiwdrgalvainpgdrkcyadtmfsllgkkfqyllcvlsydptkhpgpp
fyvphaeierlfgkicnirclekvdafeerhkswgidclfeklylltek

SCOPe Domain Coordinates for d2bzga1:

Click to download the PDB-style file with coordinates for d2bzga1.
(The format of our PDB-style files is described here.)

Timeline for d2bzga1: