Lineage for d2bsxa1 (2bsx A:3-245)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 837625Superfamily c.56.2: Purine and uridine phosphorylases [53167] (1 family) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 837626Family c.56.2.1: Purine and uridine phosphorylases [53168] (6 proteins)
  6. 837900Protein Putative uridine phosphorylase [102500] (1 species)
  7. 837901Species Plasmodium falciparum [TaxId:5833] [102501] (4 PDB entries)
  8. 837915Domain d2bsxa1: 2bsx A:3-245 [129128]
    automatically matched to d1nw4a_
    complexed with nos

Details for d2bsxa1

PDB Entry: 2bsx (more details), 2 Å

PDB Description: crystal structure of the plasmodium falciparum purine nucleoside phosphorylase complexed with inosine
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOP Domain Sequences for d2bsxa1:

Sequence, based on SEQRES records: (download)

>d2bsxa1 c.56.2.1 (A:3-245) Putative uridine phosphorylase {Plasmodium falciparum [TaxId: 5833]}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
melatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat
kya

Sequence, based on observed residues (ATOM records): (download)

>d2bsxa1 c.56.2.1 (A:3-245) Putative uridine phosphorylase {Plasmodium falciparum [TaxId: 5833]}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
melatlmvigtlrkvktggilivdgcpfkwdelvphqlenmikialgacaklatkya

SCOP Domain Coordinates for d2bsxa1:

Click to download the PDB-style file with coordinates for d2bsxa1.
(The format of our PDB-style files is described here.)

Timeline for d2bsxa1: