SCOPe 2.08: Domain d2bsxa2: 2bsx A:1-245

Lineage for d2bsxa2 (2bsx A:1-245)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein automated matches [190142] (21 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [186993] (3 PDB entries)

8. Domain d2bsxa2: 2bsx A:1-245 [129128]
   Other proteins in same PDB: d2bsxa3
   automated match to d1nw4a_
   complexed with nos

Details for d2bsxa2

PDB Entry: 2bsx, 2 Å

PDB Description: crystal structure of the plasmodium falciparum purine nucleoside phosphorylase complexed with inosine

PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d2bsxa2:

Sequence, based on SEQRES records:

>d2bsxa2 c.56.2.1 (A:1-245) automated matches {Plasmodium falciparum [TaxId: 36329]}
mdnllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkfl
cvshgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshl
lihgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaav
vemelatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacakl
atkya

Sequence, based on observed residues (ATOM records):

>d2bsxa2 c.56.2.1 (A:1-245) automated matches {Plasmodium falciparum [TaxId: 36329]}
mdnllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkfl
cvshgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshl
lihgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaav
vemelatlmvigtlrkvktggilivdgcpfkwdelvphqlenmikialgacaklatkya

Timeline for d2bsxa2:

• d2bsxa2 first appeared in SCOP 1.73, called d2bsxa1
  
• d2bsxa2 appears in SCOPe 2.07