Lineage for d2bsxa2 (2bsx A:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888641Protein automated matches [190142] (21 species)
    not a true protein
  7. 2888740Species Plasmodium falciparum [TaxId:36329] [186993] (3 PDB entries)
  8. 2888747Domain d2bsxa2: 2bsx A:1-245 [129128]
    Other proteins in same PDB: d2bsxa3
    automated match to d1nw4a_
    complexed with nos

Details for d2bsxa2

PDB Entry: 2bsx (more details), 2 Å

PDB Description: crystal structure of the plasmodium falciparum purine nucleoside phosphorylase complexed with inosine
PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d2bsxa2:

Sequence, based on SEQRES records: (download)

>d2bsxa2 c.56.2.1 (A:1-245) automated matches {Plasmodium falciparum [TaxId: 36329]}
mdnllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkfl
cvshgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshl
lihgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaav
vemelatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacakl
atkya

Sequence, based on observed residues (ATOM records): (download)

>d2bsxa2 c.56.2.1 (A:1-245) automated matches {Plasmodium falciparum [TaxId: 36329]}
mdnllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkfl
cvshgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshl
lihgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaav
vemelatlmvigtlrkvktggilivdgcpfkwdelvphqlenmikialgacaklatkya

SCOPe Domain Coordinates for d2bsxa2:

Click to download the PDB-style file with coordinates for d2bsxa2.
(The format of our PDB-style files is described here.)

Timeline for d2bsxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bsxa3