Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.1: Adenosine/AMP deaminase [51557] (2 proteins) |
Protein Adenosine deaminase (ADA) [51558] (3 species) Common fold covers the whole protein structure |
Species Plasmodium yoelii [TaxId:5861] [141799] (1 PDB entry) Uniprot Q7RMV2 8-364 |
Domain d2amxa1: 2amx A:20-376 [127024] complexed with co, unx |
PDB Entry: 2amx (more details), 2.02 Å
SCOP Domain Sequences for d2amxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]} eikflkkedvqnidlngmskkeryeiwrripkvelhchldltfsaefflkwarkynlqpn msddeildhylftkegkslaefirkaisvsdlyrdydfiedlakwaviekykegvvlmef rysptfvsssygldvelihkafikgiknatellnnkihvalicisdtghaaasikhsgdf aikhkhdfvgfdhggreidlkdhkdvyhsvrdhglhltvhagedatlpnlntlytainil nverighgirvsesdelielvkkkdillevcpisnlllnnvksmdthpirklydagvkvs vnsddpgmflsnindnyeklyihlnftleefmimnnwafeksfvsddvkselkalyf
Timeline for d2amxa1: