Lineage for d2amxa1 (2amx A:20-376)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) 
the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
has transition metal ions bound inside the barrel
Family c.1.9.1: Adenosine/AMP deaminase [51557] (2 proteins) Protein Adenosine deaminase (ADA) [51558] (3 species)
Common fold covers the whole protein structureSpecies Plasmodium yoelii [TaxId:5861] [141799] (1 PDB entry)
Uniprot Q7RMV2 8-364
Domain d2amxa1: 2amx A:20-376 [127024]
complexed with co, unx
Details for d2amxa1
PDB Entry: 2amx (more details), 2.02 Å
PDB Description: Crystal structure of Plasmodium Yoelii Adenosine deaminase (PY02076)
PDB Compounds: (A:) adenosine deaminaseSCOP Domain Sequences for d2amxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]}
eikflkkedvqnidlngmskkeryeiwrripkvelhchldltfsaefflkwarkynlqpn
msddeildhylftkegkslaefirkaisvsdlyrdydfiedlakwaviekykegvvlmef
rysptfvsssygldvelihkafikgiknatellnnkihvalicisdtghaaasikhsgdf
aikhkhdfvgfdhggreidlkdhkdvyhsvrdhglhltvhagedatlpnlntlytainil
nverighgirvsesdelielvkkkdillevcpisnlllnnvksmdthpirklydagvkvs
vnsddpgmflsnindnyeklyihlnftleefmimnnwafeksfvsddvkselkalyf
SCOP Domain Coordinates for d2amxa1:
Click to download the PDB-style file with coordinates for d2amxa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2amxa1:
- d2amxa1 first appeared in SCOP 1.73
- d2amxa1 appears in SCOPe 2.01
- d2amxa1 appears in the current release, SCOPe 2.08
View in 3D
