Lineage for d2amxa1 (2amx A:20-376)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 683612Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 683613Family c.1.9.1: Adenosine/AMP deaminase [51557] (2 proteins)
  6. 683614Protein Adenosine deaminase (ADA) [51558] (3 species)
    Common fold covers the whole protein structure
  7. 683653Species Plasmodium yoelii [TaxId:5861] [141799] (1 PDB entry)
  8. 683654Domain d2amxa1: 2amx A:20-376 [127024]
    complexed with co, unx

Details for d2amxa1

PDB Entry: 2amx (more details), 2.02 Å

PDB Description: Crystal structure of Plasmodium Yoelii Adenosine deaminase (PY02076)
PDB Compounds: (A:) adenosine deaminase

SCOP Domain Sequences for d2amxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]}
eikflkkedvqnidlngmskkeryeiwrripkvelhchldltfsaefflkwarkynlqpn
msddeildhylftkegkslaefirkaisvsdlyrdydfiedlakwaviekykegvvlmef
rysptfvsssygldvelihkafikgiknatellnnkihvalicisdtghaaasikhsgdf
aikhkhdfvgfdhggreidlkdhkdvyhsvrdhglhltvhagedatlpnlntlytainil
nverighgirvsesdelielvkkkdillevcpisnlllnnvksmdthpirklydagvkvs
vnsddpgmflsnindnyeklyihlnftleefmimnnwafeksfvsddvkselkalyf

SCOP Domain Coordinates for d2amxa1:

Click to download the PDB-style file with coordinates for d2amxa1.
(The format of our PDB-style files is described here.)

Timeline for d2amxa1: