SCOP 1.73: Domain d2amxa1: 2amx A:20-376

Lineage for d2amxa1 (2amx A:20-376)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (15 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.1: Adenosine/AMP deaminase [51557] (2 proteins)

6. Protein Adenosine deaminase (ADA) [51558] (3 species)
   Common fold covers the whole protein structure

7. Species Plasmodium yoelii [TaxId:5861] [141799] (1 PDB entry)

8. Domain d2amxa1: 2amx A:20-376 [127024]
   complexed with co, unx

Details for d2amxa1

PDB Entry: 2amx, 2.02 Å

PDB Description: Crystal structure of Plasmodium Yoelii Adenosine deaminase (PY02076)

PDB Compounds: (A:) adenosine deaminase

SCOP Domain Sequences for d2amxa1:

Sequence; same for both SEQRES and ATOM records:

>d2amxa1 c.1.9.1 (A:20-376) Adenosine deaminase (ADA) {Plasmodium yoelii [TaxId: 5861]}
eikflkkedvqnidlngmskkeryeiwrripkvelhchldltfsaefflkwarkynlqpn
msddeildhylftkegkslaefirkaisvsdlyrdydfiedlakwaviekykegvvlmef
rysptfvsssygldvelihkafikgiknatellnnkihvalicisdtghaaasikhsgdf
aikhkhdfvgfdhggreidlkdhkdvyhsvrdhglhltvhagedatlpnlntlytainil
nverighgirvsesdelielvkkkdillevcpisnlllnnvksmdthpirklydagvkvs
vnsddpgmflsnindnyeklyihlnftleefmimnnwafeksfvsddvkselkalyf

Timeline for d2amxa1:

• d2amxa1 is new in SCOP 1.73
  
• d2amxa1 appears in SCOP 1.75
  
• d2amxa1 appears in the current release, SCOPe 2.08