Lineage for d1zcba1 (1zcb A:76-201)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
5 helices; folded leafSuperfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) 
this domain interrupts the G-protein common foldFamily a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) Protein Transducin (alpha subunit), insertion domain [47897] (4 species) 
Species Mouse (Mus musculus) [TaxId:10090] [140674] (4 PDB entries)
Uniprot P21279 67-183! Uniprot P27600 82-203! Uniprot P27601 76-201
Domain d1zcba1: 1zcb A:76-201 [124901]
Other proteins in same PDB: d1zcba2
G alpha i/13
complexed with gdp
Details for d1zcba1
PDB Entry: 1zcb (more details), 2 Å
PDB Description: crystal structure of g alpha 13 in complex with gdp
PDB Compounds: (A:) G alpha i/13SCOP Domain Sequences for d1zcba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg
mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd
illarr
SCOP Domain Coordinates for d1zcba1:
Click to download the PDB-style file with coordinates for d1zcba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zcba1:
- d1zcba1 first appeared in SCOP 1.73
- d1zcba1 appears in SCOPe 2.01
- d1zcba1 appears in the current release, SCOPe 2.08
View in 3D
