SCOP 1.73: Domain d1zcba1: 1zcb A:76-201

Lineage for d1zcba1 (1zcb A:76-201)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140674] (3 PDB entries)

8. Domain d1zcba1: 1zcb A:76-201 [124901]
   Other proteins in same PDB: d1zcba2
   G alpha i/13
   complexed with gdp

Details for d1zcba1

PDB Entry: 1zcb, 2 Å

PDB Description: crystal structure of g alpha 13 in complex with gdp

PDB Compounds: (A:) G alpha i/13

SCOP Domain Sequences for d1zcba1:

Sequence; same for both SEQRES and ATOM records:

>d1zcba1 a.66.1.1 (A:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg
mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd
illarr

Timeline for d1zcba1:

• d1zcba1 is new in SCOP 1.73
  
• d1zcba1 appears in SCOP 1.75
  
• d1zcba1 appears in the current release, SCOPe 2.08