Lineage for d1zcba2 (1zcb A:47-75,A:202-372)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 829350Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 829351Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) (S)
    division into families based on beta-sheet topologies
  5. 829945Family c.37.1.8: G proteins [52592] (78 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 830709Protein Transducin (alpha subunit) [52623] (4 species)
    common fold is interrupted with an all-alpha domain
  7. 830736Species Mouse (Mus musculus) [TaxId:10090] [142225] (4 PDB entries)
    Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372
  8. 830737Domain d1zcba2: 1zcb A:47-75,A:202-372 [124902]
    Other proteins in same PDB: d1zcba1
    G alpha i/13
    complexed with gdp

Details for d1zcba2

PDB Entry: 1zcb (more details), 2 Å

PDB Description: crystal structure of g alpha 13 in complex with gdp
PDB Compounds: (A:) G alpha i/13

SCOP Domain Sequences for d1zcba2:

Sequence, based on SEQRES records: (download)

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
rlvkilllgagesgkstflkqmriihgqdXptkgiheydfeiknvpfkmvdvggqrserk
rwfecfdsvtsilflvsssefdqvlmedrqtnrlteslnifetivnnrvfsnvsiilfln
ktdlleekvqvvsikdyflefegdphclrdvqkflvecfrgkrrdqqqrplyhhfttain
tenirlvfrdvkdtilhdnlk

Sequence, based on observed residues (ATOM records): (download)

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
rlvkilllgagesgkstflkqmriihgqdXptkgiheydfeiknvpfkmvdvggwfecfd
svtsilflvsssefdqvlmedrqtnrlteslnifetivnnrvfsnvsiilflnktdllee
kvqvvsikdyflefegdphclrdvqkflvecfrgkrrdqqplyhhfttaintenirlvfr
dvkdtilhdnlk

SCOP Domain Coordinates for d1zcba2:

Click to download the PDB-style file with coordinates for d1zcba2.
(The format of our PDB-style files is described here.)

Timeline for d1zcba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zcba1