Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.11: Prokaryotic SH3-related domain [82057] (4 families) |
Family b.34.11.4: Ply C-terminal domain-like [141198] (1 protein) duplication: tandem repeat of two SH3-like domains swapped with the N-terminal strands; non-overlapping parts of sequence are covered by PfamB PB062324 and PfamB PB020199 |
Protein Endolysin Ply, C-terminal domain [141199] (1 species) |
Species Bacteriophage Psa [TaxId:171618] [141200] (1 PDB entry) Uniprot Q8W5Y8 181-314 |
Domain d1xova1: 1xov A:181-314 [122206] Other proteins in same PDB: d1xova2 complexed with cl, glu, lys, so4, trs, zn |
PDB Entry: 1xov (more details), 1.8 Å
SCOP Domain Sequences for d1xova1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xova1 b.34.11.4 (A:181-314) Endolysin Ply, C-terminal domain {Bacteriophage Psa [TaxId: 171618]} pnrhsgavvdsvpmlskmdfksspikmykagssllvyehnkywykayindklcyiyksfc isngkkdakgrikvriksakdlripvwnntklnsgkikwyspgtklswydnkkgylelwy ekdgwyytanyflk
Timeline for d1xova1: