SCOPe 2.01: Domain d1xova1: 1xov A:181-314

Lineage for d1xova1 (1xov A:181-314)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.11: Prokaryotic SH3-related domain [82057] (4 families)

5. Family b.34.11.4: Ply C-terminal domain-like [141198] (1 protein)
   duplication: tandem repeat of two SH3-like domains swapped with the N-terminal strands; non-overlapping parts of sequence are covered by PfamB PB062324 and PfamB PB020199

6. Protein Endolysin Ply, C-terminal domain [141199] (1 species)

7. Species Bacteriophage Psa [TaxId:171618] [141200] (1 PDB entry)
   Uniprot Q8W5Y8 181-314

8. Domain d1xova1: 1xov A:181-314 [122206]
   Other proteins in same PDB: d1xova2
   complexed with cl, glu, lys, so4, trs, zn

Details for d1xova1

PDB Entry: 1xov, 1.8 Å

PDB Description: The crystal structure of the listeria monocytogenes bacteriophage PSA endolysin PlyPSA

PDB Compounds: (A:) Ply protein

SCOPe Domain Sequences for d1xova1:

Sequence; same for both SEQRES and ATOM records:

>d1xova1 b.34.11.4 (A:181-314) Endolysin Ply, C-terminal domain {Bacteriophage Psa [TaxId: 171618]}
pnrhsgavvdsvpmlskmdfksspikmykagssllvyehnkywykayindklcyiyksfc
isngkkdakgrikvriksakdlripvwnntklnsgkikwyspgtklswydnkkgylelwy
ekdgwyytanyflk

Timeline for d1xova1:

• d1xova1 first appeared in SCOP 1.73
  
• d1xova1 appears in SCOP 1.75
  
• d1xova1 appears in SCOPe 2.02
  
• d1xova1 appears in the current release, SCOPe 2.08