Lineage for d1xova1 (1xov A:181-314)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665942Superfamily b.34.11: Prokaryotic SH3-related domain [82057] (4 families) (S)
  5. 665962Family b.34.11.4: Ply C-terminal domain-like [141198] (1 protein)
    duplication: tandem repeat of two SH3-like domains swapped with the N-terminal strands; non-overlapping parts of sequence are covered by PfamB 062324 and PfamB 020199
  6. 665963Protein Endolysin Ply, C-terminal domain [141199] (1 species)
  7. 665964Species Bacteriophage Psa [TaxId:171618] [141200] (1 PDB entry)
  8. 665965Domain d1xova1: 1xov A:181-314 [122206]
    Other proteins in same PDB: d1xova2
    complexed with cl, glu, lys, so4, trs, zn

Details for d1xova1

PDB Entry: 1xov (more details), 1.8 Å

PDB Description: The crystal structure of the listeria monocytogenes bacteriophage PSA endolysin PlyPSA
PDB Compounds: (A:) Ply protein

SCOP Domain Sequences for d1xova1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xova1 b.34.11.4 (A:181-314) Endolysin Ply, C-terminal domain {Bacteriophage Psa [TaxId: 171618]}
pnrhsgavvdsvpmlskmdfksspikmykagssllvyehnkywykayindklcyiyksfc
isngkkdakgrikvriksakdlripvwnntklnsgkikwyspgtklswydnkkgylelwy
ekdgwyytanyflk

SCOP Domain Coordinates for d1xova1:

Click to download the PDB-style file with coordinates for d1xova1.
(The format of our PDB-style files is described here.)

Timeline for d1xova1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xova2